Buy IGF-1 DES 1,3 1mg Peptide (USA Made)

IGF-1 DES 1mg
Special Price $75.99 was $89.99
Availability: Out of stock
SKU
IGF-1 DES 1,3 1mg

peptides

 

IGF-1 DES 1,3 for sale is available in lyophilized powder form, in 1mg vials. It is only for research purposes and not for human consumption.

ABOUT IGF-1 DES 1,3: IGF DES 1,3 stands for Insulin-like Growth Factor Desamino 1,3, also called somatomedins. It is a prototype of the parent compound called Insulin-like Growth Factor-1 ( IGF-1 ) but differs from it due to the absence of the first three amino acids located at its N-terminus. In animal test subjects, IGF des 1,3 enhanced the growth hormone effect more than IGF-1.

IGF Des 1,3 is shown to be over ten times more able to trigger hypertrophy and excessive growth of cultured cells of animals than IGF-1. However, they share a similar mechanism of action by binding to Insulin-like Growth Factor Binding Protein (IGFBP) to trigger physiological reactions such as cell proliferation at the skeletal muscle, cartilage, bone, skin and hematopoietic cells. It is also able to control DNA manufacture.

 This compound acts as an endocrine growth factor and has been shown to have an anabolic effect on tissues once it is released into the blood.

BUY IGF-1 DES 1,3 Today from LOTI LABS!

 We offer the highest grade and purity of IGF-1 DES 1,3 for sale at an affordable price in the USA. For shipping details, please click here.

For best results in your research, buy IGF-1 DES 1,3 peptides of the highest quality from LOTI LABS.

Use our products for only research/laboratory purposes. Violation is strictly forbidden. Please read our Terms and Conditions.

 Anyone using products sold by LOTI LABS for any purpose other than research/laboratory use will be added to our no-sell list.

For more information on IGF-DES 1,3 please visit Wikipedia.

 

Weight 0.0099 lbs
Appearance Fine White Lyophilized Powder
Residue Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Solubility 100 µg/mL sterile diluent (distilled de-ionized water)
Source Biosynthetic production
Stability Lyophilized protein is to be stored at -20°C.
It is recommended to divide the remaining reconstituted peptide into multiple vials
so as to avoid a cycle of freezing and thawing. Reconstituted protein can be stored at 4°C.
Molar Mass 7371.4 g/mol
CAS Number 112603-35-7
Molecular Formula C319H501N91O96S7
MG 1mg
Terms This product is sold for research/laboratory usage only. No other uses are permited.