Sermorelin
Synthetic 29-residue peptide. Loti Labs supplies it as lyophilized powder in 2 mg vials, for laboratory research.
Sermorelin corresponds to the first 29 residues of human growth hormone-releasing hormone (GHRH). Arg29 is amidated.
Specifications
Reference dataFormula, molecular weight and CAS number are reference values for the compound, not measurements of a specific batch.
- Compound
- Sermorelin
- Class
- Synthetic 29-residue peptide
- Molecular formula
- C149H246N44O42S
- Physical presentation
- Lyophilized powder, sealed vial
- Formats
- 2 mg vial
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Reference form
- Unless the product label states otherwise, the peptide is supplied as the acetate salt. The molecular formula, molecular weight and CAS number shown refer to the free sermorelin peptide.
Current certificates of analysis
TipMatch the batch number on your vial label to the certificate. Click any certificate to open it full size.
2 mg vial
Batch LL-SRM-726 tested at 99.61% purity by RP-HPLC. Identity was found to conform by mass spectrometry. Endotoxin screen: <0.05 EU/mL.
- Batch
- LL-SRM-726
- Tested
- Jul 27, 2026
- Laboratory
- Bioviridian
Batch history
RecordEvery certificate stays on record under its batch number, even after a newer batch arrives.
| Tested | Format | Batch | Purity | Identity | Laboratory | |
|---|---|---|---|---|---|---|
| Jul 27, 2026 | 2 mg vial | LL-SRM-726 | 99.61% | Conforms | Bioviridian | Certificate |
How every batch is tested
MethodEvery Loti Labs batch goes to an independent, U.S.-based third-party laboratory.
- 1
Sample sent
Samples from the production batch go to the laboratory under the batch number.
- 2
Purity
HPLC separates sample components and can be used to assess chromatographic purity. Determining absolute compound content requires a validated quantitative assay.
- 3
Identity
Mass spectrometry provides evidence supporting compound identity, where reported.
- 4
Archived
The certificate is published and kept for good. Search the archive.
Questions researchers ask
ArchiveEvery certificate we have published is searchable in the COA archive.
What purity is the current Sermorelin batch?
2 mg vial: batch LL-SRM-726 tested at 99.61% purity by RP-HPLC on Jul 27, 2026, identity confirmed by mass spectrometry.
What is the molecular formula and weight of Sermorelin?
Sermorelin has the sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, molecular formula C149H246N44O42S and a molecular weight of 3357.9 g/mol, CAS 86168-78-7. Unless the product label states otherwise, the peptide is supplied as the acetate salt. The molecular formula, molecular weight and CAS number shown refer to the free sermorelin peptide.
How do I find the certificate for my vial?
Match the lot number printed on the vial label to the batch column in the history table, or search it in the Loti Labs COA archive. Every certificate is kept permanently under its batch number.
What is Sermorelin from Loti Labs intended for?
Loti Labs supplies Sermorelin strictly for laboratory, analytical and research use. It is not for human or veterinary use, and it is not a drug, food or cosmetic.
Further reading on Sermorelin
Related compound profiles
Ordering is open to registered researchers
Sign in or create a free research account to view Sermorelin.
Research use only. This page is provided for laboratory, analytical and research reference. Products are not drugs, foods or cosmetics and are not for human or veterinary use.